PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM98910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 315aa    MW: 35780.7 Da    PI: 6.6949
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM98910.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
       KHM98910.1 14 RGPWSPEEDTKLKEYIEKHGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding37.94e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
       KHM98910.1  69 GDFSDEEDRIICSLCVNIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.681962IPR017930Myb domain
SuperFamilySSF466896.13E-2711109IPR009057Homeodomain-like
SMARTSM007175.6E-131364IPR001005SANT/Myb domain
PfamPF002491.8E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-251569IPR009057Homeodomain-like
CDDcd001679.42E-101662No hitNo description
PROSITE profilePS5129421.06463117IPR017930Myb domain
SMARTSM007173.4E-1167115IPR001005SANT/Myb domain
PfamPF002499.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDTKLKEYIE KHGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSDEEDRIIC SLCVNIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGL  120
LPLSHHRKQP SFPSSTLQNS PPSPSSDQLY GEYCTYTPLT TTSFTSNIEP FSLPSSNYAS  180
TSTTSVSHSF YQNQDSMQQC YHPTRDNNML MFGSEGSCST SSDGSCTQGR EIIKQEEIGY  240
HSYNNDYNFM LNHSNNINDG EKSCFGEWFS QTLLTPLDYD LEDIKQLISS SSSTASFNNV  300
DENKTEEKAM YYYYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0945870.0BT094587.1 Soybean clone JCVI-FLGm-18J14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242459.10.0uncharacterized protein LOC100779919
TrEMBLA0A0B2NPB10.0A0A0B2NPB1_GLYSO; Transcription factor RAX2
STRINGGLYMA12G08480.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-72myb domain protein 36
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]